Anti TMEM169 pAb (ATL-HPA062797)

Atlas Antibodies

Catalog No: ATL-HPA062797-25

• 

Product Description

Protein Description: transmembrane protein 169
Gene Name: TMEM169
Alternative Gene Name: FLJ34263
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026188: 80%, ENSRNOG00000016091: 77%
Entrez Gene ID: 92691
Uniprot ID: Q96HH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNE
• Gene Sequence: MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNE
• Gene ID - Mouse: ENSMUSG00000026188
• Gene ID - Rat: ENSRNOG00000016091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.