Description
Product Description
Protein Description: transmembrane protein 168
Gene Name: TMEM168
Alternative Gene Name: DKFZp564C012, FLJ13576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029569: 95%, ENSRNOG00000057290: 95%
Entrez Gene ID: 64418
Uniprot ID: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM168
Alternative Gene Name: DKFZp564C012, FLJ13576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029569: 95%, ENSRNOG00000057290: 95%
Entrez Gene ID: 64418
Uniprot ID: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE |
Gene Sequence | YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE |
Gene ID - Mouse | ENSMUSG00000029569 |
Gene ID - Rat | ENSRNOG00000057290 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM168 pAb (ATL-HPA077143) | |
Datasheet | Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link) |
Vendor Page | Anti TMEM168 pAb (ATL-HPA077143) at Atlas Antibodies |
Documents & Links for Anti TMEM168 pAb (ATL-HPA077143) | |
Datasheet | Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link) |
Vendor Page | Anti TMEM168 pAb (ATL-HPA077143) |