Protein Description: transmembrane protein 168
Gene Name: TMEM168
Alternative Gene Name: DKFZp564C012, FLJ13576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029569: 95%, ENSRNOG00000057290: 95%
Entrez Gene ID: 64418
Uniprot ID: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM168
Alternative Gene Name: DKFZp564C012, FLJ13576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029569: 95%, ENSRNOG00000057290: 95%
Entrez Gene ID: 64418
Uniprot ID: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE |
| Documents & Links for Anti TMEM168 pAb (ATL-HPA077143) | |
| Datasheet | Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link) |
| Vendor Page | Anti TMEM168 pAb (ATL-HPA077143) at Atlas |
| Documents & Links for Anti TMEM168 pAb (ATL-HPA077143) | |
| Datasheet | Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link) |
| Vendor Page | Anti TMEM168 pAb (ATL-HPA077143) |