Protein Description: transmembrane protein 158 (gene/pseudogene)
Gene Name: TMEM158
Alternative Gene Name: p40BBp, RIS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054871: 96%, ENSRNOG00000004757: 96%
Entrez Gene ID: 25907
Uniprot ID: Q8WZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM158
Alternative Gene Name: p40BBp, RIS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054871: 96%, ENSRNOG00000004757: 96%
Entrez Gene ID: 25907
Uniprot ID: Q8WZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL |
| Documents & Links for Anti TMEM158 pAb (ATL-HPA074974) | |
| Datasheet | Anti TMEM158 pAb (ATL-HPA074974) Datasheet (External Link) |
| Vendor Page | Anti TMEM158 pAb (ATL-HPA074974) at Atlas |
| Documents & Links for Anti TMEM158 pAb (ATL-HPA074974) | |
| Datasheet | Anti TMEM158 pAb (ATL-HPA074974) Datasheet (External Link) |
| Vendor Page | Anti TMEM158 pAb (ATL-HPA074974) |