Anti TMEM158 pAb (ATL-HPA074974)

Atlas Antibodies

Catalog No: ATL-HPA074974-25

• 

Product Description

Protein Description: transmembrane protein 158 (gene/pseudogene)
Gene Name: TMEM158
Alternative Gene Name: p40BBp, RIS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054871: 96%, ENSRNOG00000004757: 96%
Entrez Gene ID: 25907
Uniprot ID: Q8WZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL
• Gene Sequence: TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL
• Gene ID - Mouse: ENSMUSG00000054871
• Gene ID - Rat: ENSRNOG00000004757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.