Protein Description: transmembrane protein 155
Gene Name: TMEM155
Alternative Gene Name: FLJ30834
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078486: 30%, ENSRNOG00000023187: 27%
Entrez Gene ID: 132332
Uniprot ID: Q4W5P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM155
Alternative Gene Name: FLJ30834
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078486: 30%, ENSRNOG00000023187: 27%
Entrez Gene ID: 132332
Uniprot ID: Q4W5P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTR |
| Documents & Links for Anti TMEM155 pAb (ATL-HPA077585) | |
| Datasheet | Anti TMEM155 pAb (ATL-HPA077585) Datasheet (External Link) |
| Vendor Page | Anti TMEM155 pAb (ATL-HPA077585) at Atlas |
| Documents & Links for Anti TMEM155 pAb (ATL-HPA077585) | |
| Datasheet | Anti TMEM155 pAb (ATL-HPA077585) Datasheet (External Link) |
| Vendor Page | Anti TMEM155 pAb (ATL-HPA077585) |