Anti TMEM135 pAb (ATL-HPA069473)

Atlas Antibodies

Catalog No: ATL-HPA069473-25

• 

Product Description

Protein Description: transmembrane protein 135
Gene Name: TMEM135
Alternative Gene Name: FLJ22104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039428: 81%, ENSRNOG00000016815: 81%
Entrez Gene ID: 65084
Uniprot ID: Q86UB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC
• Gene Sequence: SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC
• Gene ID - Mouse: ENSMUSG00000039428
• Gene ID - Rat: ENSRNOG00000016815
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.