Protein Description: transmembrane protein 135
Gene Name: TMEM135
Alternative Gene Name: FLJ22104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039428: 81%, ENSRNOG00000016815: 81%
Entrez Gene ID: 65084
Uniprot ID: Q86UB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM135
Alternative Gene Name: FLJ22104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039428: 81%, ENSRNOG00000016815: 81%
Entrez Gene ID: 65084
Uniprot ID: Q86UB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC |
| Documents & Links for Anti TMEM135 pAb (ATL-HPA069473) | |
| Datasheet | Anti TMEM135 pAb (ATL-HPA069473) Datasheet (External Link) |
| Vendor Page | Anti TMEM135 pAb (ATL-HPA069473) at Atlas |
| Documents & Links for Anti TMEM135 pAb (ATL-HPA069473) | |
| Datasheet | Anti TMEM135 pAb (ATL-HPA069473) Datasheet (External Link) |
| Vendor Page | Anti TMEM135 pAb (ATL-HPA069473) |