Description
Product Description
Protein Description: transmembrane protein 11
Gene Name: TMEM11
Alternative Gene Name: C17orf35, PM1, PMI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043284: 95%, ENSRNOG00000005377: 97%
Entrez Gene ID: 8834
Uniprot ID: P17152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM11
Alternative Gene Name: C17orf35, PM1, PMI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043284: 95%, ENSRNOG00000005377: 97%
Entrez Gene ID: 8834
Uniprot ID: P17152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWI |
| Gene Sequence | SARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWI |
| Gene ID - Mouse | ENSMUSG00000043284 |
| Gene ID - Rat | ENSRNOG00000005377 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TMEM11 pAb (ATL-HPA062854) | |
| Datasheet | Anti TMEM11 pAb (ATL-HPA062854) Datasheet (External Link) |
| Vendor Page | Anti TMEM11 pAb (ATL-HPA062854) at Atlas Antibodies |
| Documents & Links for Anti TMEM11 pAb (ATL-HPA062854) | |
| Datasheet | Anti TMEM11 pAb (ATL-HPA062854) Datasheet (External Link) |
| Vendor Page | Anti TMEM11 pAb (ATL-HPA062854) |