![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99071/178485/atl-hpa063350_anti-tmem108-pab-atl-hpa063350_60147__55564.1681133938.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue")
Protein Description: transmembrane protein 108
Gene Name: TMEM108
Alternative Gene Name: CT124, MGC3040
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042757: 65%, ENSRNOG00000010911: 67%
Entrez Gene ID: 66000
Uniprot ID: Q6UXF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM108
Alternative Gene Name: CT124, MGC3040
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042757: 65%, ENSRNOG00000010911: 67%
Entrez Gene ID: 66000
Uniprot ID: Q6UXF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP |
| Documents & Links for Anti TMEM108 pAb (ATL-HPA063350) | |
| Datasheet | Anti TMEM108 pAb (ATL-HPA063350) Datasheet (External Link) |
| Vendor Page | Anti TMEM108 pAb (ATL-HPA063350) at Atlas |
| Documents & Links for Anti TMEM108 pAb (ATL-HPA063350) | |
| Datasheet | Anti TMEM108 pAb (ATL-HPA063350) Datasheet (External Link) |
| Vendor Page | Anti TMEM108 pAb (ATL-HPA063350) |