Anti TMED3 pAb (ATL-HPA076949)

Catalog No:
ATL-HPA076949-25
$303.00

Description

Product Description

Protein Description: transmembrane p24 trafficking protein 3
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Gene Sequence DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Gene ID - Mouse ENSMUSG00000032353
Gene ID - Rat ENSRNOG00000013889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMED3 pAb (ATL-HPA076949)
Datasheet Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link)
Vendor Page Anti TMED3 pAb (ATL-HPA076949) at Atlas Antibodies

Documents & Links for Anti TMED3 pAb (ATL-HPA076949)
Datasheet Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link)
Vendor Page Anti TMED3 pAb (ATL-HPA076949)

Product Description

Protein Description: transmembrane p24 trafficking protein 3
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Gene Sequence DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Gene ID - Mouse ENSMUSG00000032353
Gene ID - Rat ENSRNOG00000013889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMED3 pAb (ATL-HPA076949)
Datasheet Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link)
Vendor Page Anti TMED3 pAb (ATL-HPA076949) at Atlas Antibodies

Documents & Links for Anti TMED3 pAb (ATL-HPA076949)
Datasheet Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link)
Vendor Page Anti TMED3 pAb (ATL-HPA076949)