Protein Description: transmembrane p24 trafficking protein 3
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DPQGNTIYRETKKQYDSFTYRAEVKGVYQF |
| Documents & Links for Anti TMED3 pAb (ATL-HPA076949) | |
| Datasheet | Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link) |
| Vendor Page | Anti TMED3 pAb (ATL-HPA076949) at Atlas |
| Documents & Links for Anti TMED3 pAb (ATL-HPA076949) | |
| Datasheet | Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link) |
| Vendor Page | Anti TMED3 pAb (ATL-HPA076949) |