Anti TMCO1 pAb (ATL-HPA078775)

Atlas Antibodies

Catalog No: ATL-HPA078775-25

• 

Product Description

Protein Description: transmembrane and coiled-coil domains 1
Gene Name: TMCO1
Alternative Gene Name: HP10122, TMCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052428: 100%, ENSRNOG00000003928: 100%
Entrez Gene ID: 54499
Uniprot ID: Q9UM00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRM
• Gene Sequence: YRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRM
• Gene ID - Mouse: ENSMUSG00000052428
• Gene ID - Rat: ENSRNOG00000003928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.