Protein Description: transmembrane and coiled-coil domains 1
Gene Name: TMCO1
Alternative Gene Name: HP10122, TMCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052428: 100%, ENSRNOG00000003928: 100%
Entrez Gene ID: 54499
Uniprot ID: Q9UM00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMCO1
Alternative Gene Name: HP10122, TMCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052428: 100%, ENSRNOG00000003928: 100%
Entrez Gene ID: 54499
Uniprot ID: Q9UM00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRM |
Documents & Links for Anti TMCO1 pAb (ATL-HPA078775) | |
Datasheet | Anti TMCO1 pAb (ATL-HPA078775) Datasheet (External Link) |
Vendor Page | Anti TMCO1 pAb (ATL-HPA078775) at Atlas |
Documents & Links for Anti TMCO1 pAb (ATL-HPA078775) | |
Datasheet | Anti TMCO1 pAb (ATL-HPA078775) Datasheet (External Link) |
Vendor Page | Anti TMCO1 pAb (ATL-HPA078775) |