Description
Product Description
Protein Description: transmembrane 9 superfamily protein member 4
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE |
Gene Sequence | EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE |
Gene ID - Mouse | ENSMUSG00000068040 |
Gene ID - Rat | ENSRNOG00000009406 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099) | |
Datasheet | Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link) |
Vendor Page | Anti TM9SF4 pAb (ATL-HPA064099) at Atlas Antibodies |
Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099) | |
Datasheet | Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link) |
Vendor Page | Anti TM9SF4 pAb (ATL-HPA064099) |