Anti TM9SF4 pAb (ATL-HPA064099)

Catalog No:
ATL-HPA064099-25
$303.00

Description

Product Description

Protein Description: transmembrane 9 superfamily protein member 4
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Gene Sequence EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Gene ID - Mouse ENSMUSG00000068040
Gene ID - Rat ENSRNOG00000009406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099)
Datasheet Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link)
Vendor Page Anti TM9SF4 pAb (ATL-HPA064099) at Atlas Antibodies

Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099)
Datasheet Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link)
Vendor Page Anti TM9SF4 pAb (ATL-HPA064099)

Product Description

Protein Description: transmembrane 9 superfamily protein member 4
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Gene Sequence EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Gene ID - Mouse ENSMUSG00000068040
Gene ID - Rat ENSRNOG00000009406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099)
Datasheet Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link)
Vendor Page Anti TM9SF4 pAb (ATL-HPA064099) at Atlas Antibodies

Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099)
Datasheet Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link)
Vendor Page Anti TM9SF4 pAb (ATL-HPA064099)