![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line CACO-2](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99289/178789/atl-hpa064099_anti-tm9sf4-pab-atl-hpa064099_60451__03008.1681134345.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line CACO-2")
Protein Description: transmembrane 9 superfamily protein member 4
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE |
| Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099) | |
| Datasheet | Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link) |
| Vendor Page | Anti TM9SF4 pAb (ATL-HPA064099) at Atlas |
| Documents & Links for Anti TM9SF4 pAb (ATL-HPA064099) | |
| Datasheet | Anti TM9SF4 pAb (ATL-HPA064099) Datasheet (External Link) |
| Vendor Page | Anti TM9SF4 pAb (ATL-HPA064099) |