Protein Description: transmembrane 4 L six family member 20
Gene Name: TM4SF20
Alternative Gene Name: FLJ22800, TCCE518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026149: 63%, ENSRNOG00000015460: 60%
Entrez Gene ID: 79853
Uniprot ID: Q53R12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TM4SF20
Alternative Gene Name: FLJ22800, TCCE518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026149: 63%, ENSRNOG00000015460: 60%
Entrez Gene ID: 79853
Uniprot ID: Q53R12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QALLKGPLMCNSPSNSNANCEFSLKNISDI |
Documents & Links for Anti TM4SF20 pAb (ATL-HPA063184) | |
Datasheet | Anti TM4SF20 pAb (ATL-HPA063184) Datasheet (External Link) |
Vendor Page | Anti TM4SF20 pAb (ATL-HPA063184) at Atlas |
Documents & Links for Anti TM4SF20 pAb (ATL-HPA063184) | |
Datasheet | Anti TM4SF20 pAb (ATL-HPA063184) Datasheet (External Link) |
Vendor Page | Anti TM4SF20 pAb (ATL-HPA063184) |