Protein Description: toll like receptor 10
Gene Name: TLR10
Alternative Gene Name: CD290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044827: 53%, ENSRNOG00000038722: 49%
Entrez Gene ID: 81793
Uniprot ID: Q9BXR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TLR10
Alternative Gene Name: CD290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044827: 53%, ENSRNOG00000038722: 49%
Entrez Gene ID: 81793
Uniprot ID: Q9BXR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY |
| Documents & Links for Anti TLR10 pAb (ATL-HPA066755) | |
| Datasheet | Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link) |
| Vendor Page | Anti TLR10 pAb (ATL-HPA066755) at Atlas |
| Documents & Links for Anti TLR10 pAb (ATL-HPA066755) | |
| Datasheet | Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link) |
| Vendor Page | Anti TLR10 pAb (ATL-HPA066755) |