Anti TLR10 pAb (ATL-HPA066755)

Catalog No:
ATL-HPA066755-25
$395.00

Description

Product Description

Protein Description: toll like receptor 10
Gene Name: TLR10
Alternative Gene Name: CD290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044827: 53%, ENSRNOG00000038722: 49%
Entrez Gene ID: 81793
Uniprot ID: Q9BXR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY
Gene Sequence ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY
Gene ID - Mouse ENSMUSG00000044827
Gene ID - Rat ENSRNOG00000038722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TLR10 pAb (ATL-HPA066755)
Datasheet Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link)
Vendor Page Anti TLR10 pAb (ATL-HPA066755) at Atlas Antibodies

Documents & Links for Anti TLR10 pAb (ATL-HPA066755)
Datasheet Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link)
Vendor Page Anti TLR10 pAb (ATL-HPA066755)

Product Description

Protein Description: toll like receptor 10
Gene Name: TLR10
Alternative Gene Name: CD290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044827: 53%, ENSRNOG00000038722: 49%
Entrez Gene ID: 81793
Uniprot ID: Q9BXR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY
Gene Sequence ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY
Gene ID - Mouse ENSMUSG00000044827
Gene ID - Rat ENSRNOG00000038722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TLR10 pAb (ATL-HPA066755)
Datasheet Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link)
Vendor Page Anti TLR10 pAb (ATL-HPA066755) at Atlas Antibodies

Documents & Links for Anti TLR10 pAb (ATL-HPA066755)
Datasheet Anti TLR10 pAb (ATL-HPA066755) Datasheet (External Link)
Vendor Page Anti TLR10 pAb (ATL-HPA066755)