Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)

Catalog No:
ATL-HPA058799-25
$303.00

Description

Product Description

Protein Description: TIMELESS interacting protein
Gene Name: TIPIN
Alternative Gene Name: FLJ20516
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032397: 80%, ENSRNOG00000043068: 78%
Entrez Gene ID: 54962
Uniprot ID: Q9BVW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene Sequence HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene ID - Mouse ENSMUSG00000032397
Gene ID - Rat ENSRNOG00000043068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)

Product Description

Protein Description: TIMELESS interacting protein
Gene Name: TIPIN
Alternative Gene Name: FLJ20516
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032397: 80%, ENSRNOG00000043068: 78%
Entrez Gene ID: 54962
Uniprot ID: Q9BVW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene Sequence HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene ID - Mouse ENSMUSG00000032397
Gene ID - Rat ENSRNOG00000043068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)