Anti TINF2 pAb (ATL-HPA069807)

Atlas Antibodies

Catalog No: ATL-HPA069807-25

• 
• 

Product Description

Protein Description: TERF1 (TRF1)-interacting nuclear factor 2
Gene Name: TINF2
Alternative Gene Name: TIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007589: 66%, ENSRNOG00000020189: 61%
Entrez Gene ID: 26277
Uniprot ID: Q9BSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
• Gene Sequence: FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
• Gene ID - Mouse: ENSMUSG00000007589
• Gene ID - Rat: ENSRNOG00000020189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.