Protein Description: TERF1 (TRF1)-interacting nuclear factor 2
Gene Name: TINF2
Alternative Gene Name: TIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007589: 66%, ENSRNOG00000020189: 61%
Entrez Gene ID: 26277
Uniprot ID: Q9BSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TINF2
Alternative Gene Name: TIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007589: 66%, ENSRNOG00000020189: 61%
Entrez Gene ID: 26277
Uniprot ID: Q9BSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL |
| Documents & Links for Anti TINF2 pAb (ATL-HPA069807) | |
| Datasheet | Anti TINF2 pAb (ATL-HPA069807) Datasheet (External Link) |
| Vendor Page | Anti TINF2 pAb (ATL-HPA069807) at Atlas |
| Documents & Links for Anti TINF2 pAb (ATL-HPA069807) | |
| Datasheet | Anti TINF2 pAb (ATL-HPA069807) Datasheet (External Link) |
| Vendor Page | Anti TINF2 pAb (ATL-HPA069807) |