![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus & vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104427/184336/atl-hpa068391_anti-timp3-atl-hpa068391_67796__72382.1710522761.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus & vesicles.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus & vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104427/184336/atl-hpa068391_anti-timp3-atl-hpa068391_67796__72382.1710522761.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus & vesicles.")
Polyclonal Antibody against Human TIMP3, Gene description: TIMP metallopeptidase inhibitor 3, Alternative Gene Names: SFD, Validated applications: ICC, Uniprot ID: P35625, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
| Documents & Links for Anti-TIMP3 pAb (ATL-HPA068391) | |
| Vendor Page | Anti-TIMP3 pAb (ATL-HPA068391) at Atlas |
| Documents & Links for Anti-TIMP3 pAb (ATL-HPA068391) | |
| Vendor Page | Anti-TIMP3 pAb (ATL-HPA068391) |