Anti TIMMDC1 pAb (ATL-HPA055846)

Atlas Antibodies

Catalog No: ATL-HPA055846-25

• 
• 

Product Description

Protein Description: translocase of inner mitochondrial membrane domain containing 1
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 53%, ENSRNOG00000002999: 53%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN
• Gene Sequence: AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN
• Gene ID - Mouse: ENSMUSG00000002846
• Gene ID - Rat: ENSRNOG00000002999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.