Description
Product Description
Protein Description: translocase of inner mitochondrial membrane domain containing 1
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 53%, ENSRNOG00000002999: 53%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 53%, ENSRNOG00000002999: 53%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN |
Gene Sequence | AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN |
Gene ID - Mouse | ENSMUSG00000002846 |
Gene ID - Rat | ENSRNOG00000002999 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TIMMDC1 pAb (ATL-HPA055846) | |
Datasheet | Anti TIMMDC1 pAb (ATL-HPA055846) Datasheet (External Link) |
Vendor Page | Anti TIMMDC1 pAb (ATL-HPA055846) at Atlas Antibodies |
Documents & Links for Anti TIMMDC1 pAb (ATL-HPA055846) | |
Datasheet | Anti TIMMDC1 pAb (ATL-HPA055846) Datasheet (External Link) |
Vendor Page | Anti TIMMDC1 pAb (ATL-HPA055846) |