Anti TIMM44 pAb (ATL-HPA073108)

Atlas Antibodies

Catalog No: ATL-HPA073108-25

• 
• 

Product Description

Protein Description: translocase of inner mitochondrial membrane 44
Gene Name: TIMM44
Alternative Gene Name: TIM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002949: 93%, ENSRNOG00000001058: 94%
Entrez Gene ID: 10469
Uniprot ID: O43615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY
• Gene Sequence: TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY
• Gene ID - Mouse: ENSMUSG00000002949
• Gene ID - Rat: ENSRNOG00000001058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.