Protein Description: tigger transposable element derived 2
Gene Name: TIGD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049232: 81%, ENSRNOG00000038449: 81%
Entrez Gene ID: 166815
Uniprot ID: Q4W5G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TIGD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049232: 81%, ENSRNOG00000038449: 81%
Entrez Gene ID: 166815
Uniprot ID: Q4W5G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTD |
| Documents & Links for Anti TIGD2 pAb (ATL-HPA071168) | |
| Datasheet | Anti TIGD2 pAb (ATL-HPA071168) Datasheet (External Link) |
| Vendor Page | Anti TIGD2 pAb (ATL-HPA071168) at Atlas |
| Documents & Links for Anti TIGD2 pAb (ATL-HPA071168) | |
| Datasheet | Anti TIGD2 pAb (ATL-HPA071168) Datasheet (External Link) |
| Vendor Page | Anti TIGD2 pAb (ATL-HPA071168) |