Anti THSD7B pAb (ATL-HPA056745)

Atlas Antibodies

Catalog No: ATL-HPA056745-25

• 

Product Description

Protein Description: thrombospondin, type I, domain containing 7B
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 84%, ENSRNOG00000003878: 82%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV
• Gene Sequence: PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV
• Gene ID - Mouse: ENSMUSG00000042581
• Gene ID - Rat: ENSRNOG00000003878
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.