Protein Description: thrombospondin, type I, domain containing 7B
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 87%, ENSRNOG00000003878: 90%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 87%, ENSRNOG00000003878: 90%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW |
| Documents & Links for Anti THSD7B pAb (ATL-HPA051416) | |
| Datasheet | Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link) |
| Vendor Page | Anti THSD7B pAb (ATL-HPA051416) at Atlas |
| Documents & Links for Anti THSD7B pAb (ATL-HPA051416) | |
| Datasheet | Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link) |
| Vendor Page | Anti THSD7B pAb (ATL-HPA051416) |