Anti THSD7B pAb (ATL-HPA051416)

Catalog No:
ATL-HPA051416-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: thrombospondin, type I, domain containing 7B
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 87%, ENSRNOG00000003878: 90%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW
Gene ID - Mouse ENSMUSG00000042581
Gene ID - Rat ENSMUSG00000042581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti THSD7B pAb (ATL-HPA051416)
Datasheet Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link)
Vendor Page Anti THSD7B pAb (ATL-HPA051416) at Atlas

Documents & Links for Anti THSD7B pAb (ATL-HPA051416)
Datasheet Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link)
Vendor Page Anti THSD7B pAb (ATL-HPA051416)