Description
Product Description
Protein Description: theg spermatid protein-like
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 68%, ENSRNOG00000002085: 68%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 68%, ENSRNOG00000002085: 68%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IALAKSKSVHQDYLPDRDAHWPVSYATTHSKASPRIQELANPNKRAPVRIVYYDPDVFKTKPAALKAQCSQRIWELSQ |
Gene Sequence | IALAKSKSVHQDYLPDRDAHWPVSYATTHSKASPRIQELANPNKRAPVRIVYYDPDVFKTKPAALKAQCSQRIWELSQ |
Gene ID - Mouse | ENSMUSG00000029248 |
Gene ID - Rat | ENSRNOG00000002085 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti THEGL pAb (ATL-HPA068093) | |
Datasheet | Anti THEGL pAb (ATL-HPA068093) Datasheet (External Link) |
Vendor Page | Anti THEGL pAb (ATL-HPA068093) at Atlas Antibodies |
Documents & Links for Anti THEGL pAb (ATL-HPA068093) | |
Datasheet | Anti THEGL pAb (ATL-HPA068093) Datasheet (External Link) |
Vendor Page | Anti THEGL pAb (ATL-HPA068093) |