Protein Description: theg spermatid protein-like
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 68%, ENSRNOG00000002085: 68%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 68%, ENSRNOG00000002085: 68%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IALAKSKSVHQDYLPDRDAHWPVSYATTHSKASPRIQELANPNKRAPVRIVYYDPDVFKTKPAALKAQCSQRIWELSQ |
| Documents & Links for Anti THEGL pAb (ATL-HPA068093) | |
| Datasheet | Anti THEGL pAb (ATL-HPA068093) Datasheet (External Link) |
| Vendor Page | Anti THEGL pAb (ATL-HPA068093) at Atlas |
| Documents & Links for Anti THEGL pAb (ATL-HPA068093) | |
| Datasheet | Anti THEGL pAb (ATL-HPA068093) Datasheet (External Link) |
| Vendor Page | Anti THEGL pAb (ATL-HPA068093) |