Description
Product Description
Protein Description: thrombospondin 3
Gene Name: THBS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028047: 95%, ENSRNOG00000059903: 96%
Entrez Gene ID: 7059
Uniprot ID: P49746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THBS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028047: 95%, ENSRNOG00000059903: 96%
Entrez Gene ID: 7059
Uniprot ID: P49746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS |
Gene Sequence | VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS |
Gene ID - Mouse | ENSMUSG00000028047 |
Gene ID - Rat | ENSRNOG00000059903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti THBS3 pAb (ATL-HPA073242) | |
Datasheet | Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link) |
Vendor Page | Anti THBS3 pAb (ATL-HPA073242) at Atlas Antibodies |
Documents & Links for Anti THBS3 pAb (ATL-HPA073242) | |
Datasheet | Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link) |
Vendor Page | Anti THBS3 pAb (ATL-HPA073242) |