Protein Description: thrombospondin 3
Gene Name: THBS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028047: 95%, ENSRNOG00000059903: 96%
Entrez Gene ID: 7059
Uniprot ID: P49746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THBS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028047: 95%, ENSRNOG00000059903: 96%
Entrez Gene ID: 7059
Uniprot ID: P49746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS |
| Documents & Links for Anti THBS3 pAb (ATL-HPA073242) | |
| Datasheet | Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link) |
| Vendor Page | Anti THBS3 pAb (ATL-HPA073242) at Atlas |
| Documents & Links for Anti THBS3 pAb (ATL-HPA073242) | |
| Datasheet | Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link) |
| Vendor Page | Anti THBS3 pAb (ATL-HPA073242) |