Anti THBS1 pAb (ATL-HPA059756)

Atlas Antibodies

Catalog No: ATL-HPA059756-25

• 

Product Description

Protein Description: thrombospondin 1
Gene Name: THBS1
Alternative Gene Name: THBS, THBS-1, TSP, TSP-1, TSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040152: 94%, ENSRNOG00000045829: 97%
Entrez Gene ID: 7057
Uniprot ID: P07996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRC
• Gene Sequence: LTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRC
• Gene ID - Mouse: ENSMUSG00000040152
• Gene ID - Rat: ENSRNOG00000045829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.