Anti THAP8 pAb (ATL-HPA064056)

Atlas Antibodies

Catalog No: ATL-HPA064056-25

• 

Product Description

Protein Description: THAP domain containing 8
Gene Name: THAP8
Alternative Gene Name: FLJ32891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 45%, ENSRNOG00000018351: 45%
Entrez Gene ID: 199745
Uniprot ID: Q8NA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS
• Gene Sequence: MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS
• Gene ID - Mouse: ENSMUSG00000026279
• Gene ID - Rat: ENSRNOG00000018351
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.