Protein Description: THAP domain containing 8
Gene Name: THAP8
Alternative Gene Name: FLJ32891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 45%, ENSRNOG00000018351: 45%
Entrez Gene ID: 199745
Uniprot ID: Q8NA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THAP8
Alternative Gene Name: FLJ32891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 45%, ENSRNOG00000018351: 45%
Entrez Gene ID: 199745
Uniprot ID: Q8NA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS |
Documents & Links for Anti THAP8 pAb (ATL-HPA064056) | |
Datasheet | Anti THAP8 pAb (ATL-HPA064056) Datasheet (External Link) |
Vendor Page | Anti THAP8 pAb (ATL-HPA064056) at Atlas |
Documents & Links for Anti THAP8 pAb (ATL-HPA064056) | |
Datasheet | Anti THAP8 pAb (ATL-HPA064056) Datasheet (External Link) |
Vendor Page | Anti THAP8 pAb (ATL-HPA064056) |