Protein Description: THAP domain containing, apoptosis associated protein 1
Gene Name: THAP1
Alternative Gene Name: 4833431A01Rik, DYT6, FLJ10477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037214: 95%, ENSRNOG00000056956: 94%
Entrez Gene ID: 55145
Uniprot ID: Q9NVV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THAP1
Alternative Gene Name: 4833431A01Rik, DYT6, FLJ10477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037214: 95%, ENSRNOG00000056956: 94%
Entrez Gene ID: 55145
Uniprot ID: Q9NVV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF |
| Documents & Links for Anti THAP1 pAb (ATL-HPA071310) | |
| Datasheet | Anti THAP1 pAb (ATL-HPA071310) Datasheet (External Link) |
| Vendor Page | Anti THAP1 pAb (ATL-HPA071310) at Atlas |
| Documents & Links for Anti THAP1 pAb (ATL-HPA071310) | |
| Datasheet | Anti THAP1 pAb (ATL-HPA071310) Datasheet (External Link) |
| Vendor Page | Anti THAP1 pAb (ATL-HPA071310) |