Protein Description: tyrosine hydroxylase
Gene Name: TH
Alternative Gene Name: DYT5b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000214: 88%, ENSRNOG00000020410: 88%
Entrez Gene ID: 7054
Uniprot ID: P07101
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TH
Alternative Gene Name: DYT5b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000214: 88%, ENSRNOG00000020410: 88%
Entrez Gene ID: 7054
Uniprot ID: P07101
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
| Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation) | |
| Datasheet | Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TH pAb (ATL-HPA061003 w/enhanced validation) at Atlas |
| Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation) | |
| Datasheet | Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TH pAb (ATL-HPA061003 w/enhanced validation) |
| Citations for Anti TH pAb (ATL-HPA061003 w/enhanced validation) – 2 Found |
| Mastitskaya, Svetlana; Turovsky, Egor; Marina, Nephtali; Theparambil, Shefeeq M; Hadjihambi, Anna; Kasparov, Sergey; Teschemacher, Anja G; Ramage, Andrew G; Gourine, Alexander V; Hosford, Patrick S. Astrocytes Modulate Baroreflex Sensitivity at the Level of the Nucleus of the Solitary Tract. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(15):3052-3062. PubMed |
| Yang, Weiwei; Hao, Wenwen; Meng, Zhuo; Ding, Shiyan; Li, Xiaodi; Zhang, Tao; Huang, Weixiao; Xu, Lian; Zhang, Yu; Yang, Jian; Gu, Xiaosong. Molecular Regulatory Mechanism and Toxicology of Neurodegenerative Processes in MPTP/Probenecid-Induced Progressive Parkinson's Disease Mice Model Revealed by Transcriptome. Molecular Neurobiology. 2021;58(2):603-616. PubMed |