Anti TGM4 pAb (ATL-HPA073290 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA073290-25

• 

Product Description

Protein Description: transglutaminase 4
Gene Name: TGM4
Alternative Gene Name: TGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025787: 54%, ENSRNOG00000004320: 56%
Entrez Gene ID: 7047
Uniprot ID: P49221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPEFSIELPNTGRIGQLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCTPIKTGPKKFIVKLSSKQVK
• Gene Sequence: YPEFSIELPNTGRIGQLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCTPIKTGPKKFIVKLSSKQVK
• Gene ID - Mouse: ENSMUSG00000025787
• Gene ID - Rat: ENSRNOG00000004320
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.