Anti TGM2 pAb (ATL-HPA021019 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA021019-25

• 
• 

Product Description

Protein Description: transglutaminase 2
Gene Name: TGM2
Alternative Gene Name: TGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037820: 81%, ENSRNOG00000012956: 78%
Entrez Gene ID: 7052
Uniprot ID: P21980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTK
• Gene Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTK
• Gene ID - Mouse: ENSMUSG00000037820
• Gene ID - Rat: ENSRNOG00000012956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti TGM2 pAb (ATL-HPA021019 w/enhanced validation) – 1 Found

Hernandez-Fernaud, Juan R; Ruengeler, Elena; Casazza, Andrea; Neilson, Lisa J; Pulleine, Ellie; Santi, Alice; Ismail, Shehab; Lilla, Sergio; Dhayade, Sandeep; MacPherson, Iain R; McNeish, Iain; Ennis, Darren; Ali, Hala; Kugeratski, Fernanda G; Al Khamici, Heba; van den Biggelaar, Maartje; van den Berghe, Peter V E; Cloix, Catherine; McDonald, Laura; Millan, David; Hoyle, Aoisha; Kuchnio, Anna; Carmeliet, Peter; Valenzuela, Stella M; Blyth, Karen; Yin, Huabing; Mazzone, Massimiliano; Norman, Jim C; Zanivan, Sara. Secreted CLIC3 drives cancer progression through its glutathione-dependent oxidoreductase activity. Nature Communications. 2017;8( 28198360):14206.