Protein Description: transforming growth factor, beta 3
Gene Name: TGFB3
Alternative Gene Name: ARVD, ARVD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021253: 95%, ENSRNOG00000009867: 95%
Entrez Gene ID: 7043
Uniprot ID: P10600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TGFB3
Alternative Gene Name: ARVD, ARVD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021253: 95%, ENSRNOG00000009867: 95%
Entrez Gene ID: 7043
Uniprot ID: P10600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ |
Documents & Links for Anti TGFB3 pAb (ATL-HPA063582) | |
Datasheet | Anti TGFB3 pAb (ATL-HPA063582) Datasheet (External Link) |
Vendor Page | Anti TGFB3 pAb (ATL-HPA063582) at Atlas |
Documents & Links for Anti TGFB3 pAb (ATL-HPA063582) | |
Datasheet | Anti TGFB3 pAb (ATL-HPA063582) Datasheet (External Link) |
Vendor Page | Anti TGFB3 pAb (ATL-HPA063582) |