Anti TGFB3 pAb (ATL-HPA063582)

Atlas Antibodies

Catalog No: ATL-HPA063582-25

• 

Product Description

Protein Description: transforming growth factor, beta 3
Gene Name: TGFB3
Alternative Gene Name: ARVD, ARVD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021253: 95%, ENSRNOG00000009867: 95%
Entrez Gene ID: 7043
Uniprot ID: P10600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ
• Gene Sequence: HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ
• Gene ID - Mouse: ENSMUSG00000021253
• Gene ID - Rat: ENSRNOG00000009867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.