Anti TEX44 pAb (ATL-HPA056433 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056433-25

• 

Product Description

Protein Description: testis expressed 44
Gene Name: TEX44
Alternative Gene Name: C2orf57, MGC35154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053286: 32%, ENSRNOG00000052424: 31%
Entrez Gene ID: 165100
Uniprot ID: Q53QW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHP
• Gene Sequence: SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHP
• Gene ID - Mouse: ENSMUSG00000053286
• Gene ID - Rat: ENSRNOG00000052424
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.