Protein Description: testis expressed 37
Gene Name: TEX37
Alternative Gene Name: C2orf51, FLJ25369, TSC21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051896: 60%, ENSRNOG00000006476: 58%
Entrez Gene ID: 200523
Uniprot ID: Q96LM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEX37
Alternative Gene Name: C2orf51, FLJ25369, TSC21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051896: 60%, ENSRNOG00000006476: 58%
Entrez Gene ID: 200523
Uniprot ID: Q96LM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCH |
Documents & Links for Anti TEX37 pAb (ATL-HPA070239) | |
Datasheet | Anti TEX37 pAb (ATL-HPA070239) Datasheet (External Link) |
Vendor Page | Anti TEX37 pAb (ATL-HPA070239) at Atlas |
Documents & Links for Anti TEX37 pAb (ATL-HPA070239) | |
Datasheet | Anti TEX37 pAb (ATL-HPA070239) Datasheet (External Link) |
Vendor Page | Anti TEX37 pAb (ATL-HPA070239) |