![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104692/184345/atl-hpa077263_anti-tex36-atl-hpa077263_67805__52409.1710522768.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104692/184345/atl-hpa077263_anti-tex36-atl-hpa077263_67805__52409.1710522768.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.")
Description
Product Description
Polyclonal Antibody against Human TEX36, Gene description: testis expressed 36, Alternative Gene Names: bA383C5.1, C10orf122, Validated applications: ICC, Uniprot ID: Q5VZQ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSFRRFPRCYKEIWNAFTFLPE |
| Gene Sequence | NFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSFRRFPRCYKEIWNAFTFLPE |
| Gene ID - Mouse | ENSMUSG00000030976 |
| Gene ID - Rat | ENSRNOG00000026848 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti-TEX36 pAb (ATL-HPA077263) | |
| Vendor Page | Anti-TEX36 pAb (ATL-HPA077263) at Atlas Antibodies |
| Documents & Links for Anti-TEX36 pAb (ATL-HPA077263) | |
| Vendor Page | Anti-TEX36 pAb (ATL-HPA077263) |