Description
Product Description
Protein Description: testis expressed 22
Gene Name: TEX22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012211: 49%, ENSRNOG00000028158: 47%
Entrez Gene ID: 647310
Uniprot ID: C9J3V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEX22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012211: 49%, ENSRNOG00000028158: 47%
Entrez Gene ID: 647310
Uniprot ID: C9J3V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS |
Gene Sequence | QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS |
Gene ID - Mouse | ENSMUSG00000012211 |
Gene ID - Rat | ENSRNOG00000028158 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TEX22 pAb (ATL-HPA065576) | |
Datasheet | Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link) |
Vendor Page | Anti TEX22 pAb (ATL-HPA065576) at Atlas Antibodies |
Documents & Links for Anti TEX22 pAb (ATL-HPA065576) | |
Datasheet | Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link) |
Vendor Page | Anti TEX22 pAb (ATL-HPA065576) |