Anti TEX22 pAb (ATL-HPA065576)

Catalog No:
ATL-HPA065576-25
$303.00

Description

Product Description

Protein Description: testis expressed 22
Gene Name: TEX22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012211: 49%, ENSRNOG00000028158: 47%
Entrez Gene ID: 647310
Uniprot ID: C9J3V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS
Gene Sequence QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS
Gene ID - Mouse ENSMUSG00000012211
Gene ID - Rat ENSRNOG00000028158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEX22 pAb (ATL-HPA065576)
Datasheet Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link)
Vendor Page Anti TEX22 pAb (ATL-HPA065576) at Atlas Antibodies

Documents & Links for Anti TEX22 pAb (ATL-HPA065576)
Datasheet Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link)
Vendor Page Anti TEX22 pAb (ATL-HPA065576)

Product Description

Protein Description: testis expressed 22
Gene Name: TEX22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012211: 49%, ENSRNOG00000028158: 47%
Entrez Gene ID: 647310
Uniprot ID: C9J3V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS
Gene Sequence QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS
Gene ID - Mouse ENSMUSG00000012211
Gene ID - Rat ENSRNOG00000028158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEX22 pAb (ATL-HPA065576)
Datasheet Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link)
Vendor Page Anti TEX22 pAb (ATL-HPA065576) at Atlas Antibodies

Documents & Links for Anti TEX22 pAb (ATL-HPA065576)
Datasheet Anti TEX22 pAb (ATL-HPA065576) Datasheet (External Link)
Vendor Page Anti TEX22 pAb (ATL-HPA065576)