Protein Description: testis expressed 13A
Gene Name: TEX13A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071686: 43%, ENSRNOG00000031364: 26%
Entrez Gene ID: 56157
Uniprot ID: Q9BXU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEX13A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071686: 43%, ENSRNOG00000031364: 26%
Entrez Gene ID: 56157
Uniprot ID: Q9BXU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDC |
Documents & Links for Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) | |
Datasheet | Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) at Atlas |
Documents & Links for Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) | |
Datasheet | Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TEX13A pAb (ATL-HPA072257 w/enhanced validation) |