Protein Description: thymocyte expressed, positive selection associated 1
Gene Name: TESPA1
Alternative Gene Name: KIAA0748
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037855: 25%, ENSRNOG00000025889: 26%
Entrez Gene ID: 9840
Uniprot ID: A2RU30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TESPA1
Alternative Gene Name: KIAA0748
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037855: 25%, ENSRNOG00000025889: 26%
Entrez Gene ID: 9840
Uniprot ID: A2RU30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQT |
| Documents & Links for Anti TESPA1 pAb (ATL-HPA058823) | |
| Datasheet | Anti TESPA1 pAb (ATL-HPA058823) Datasheet (External Link) |
| Vendor Page | Anti TESPA1 pAb (ATL-HPA058823) at Atlas |
| Documents & Links for Anti TESPA1 pAb (ATL-HPA058823) | |
| Datasheet | Anti TESPA1 pAb (ATL-HPA058823) Datasheet (External Link) |
| Vendor Page | Anti TESPA1 pAb (ATL-HPA058823) |