Protein Description: testis-specific kinase 2
Gene Name: TESK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033985: 83%, ENSRNOG00000017282: 89%
Entrez Gene ID: 10420
Uniprot ID: Q96S53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TESK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033985: 83%, ENSRNOG00000017282: 89%
Entrez Gene ID: 10420
Uniprot ID: Q96S53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPF |
Documents & Links for Anti TESK2 pAb (ATL-HPA063869) | |
Datasheet | Anti TESK2 pAb (ATL-HPA063869) Datasheet (External Link) |
Vendor Page | Anti TESK2 pAb (ATL-HPA063869) at Atlas |
Documents & Links for Anti TESK2 pAb (ATL-HPA063869) | |
Datasheet | Anti TESK2 pAb (ATL-HPA063869) Datasheet (External Link) |
Vendor Page | Anti TESK2 pAb (ATL-HPA063869) |