Protein Description: TEPSIN, adaptor related protein complex 4 accessory protein
Gene Name: TEPSIN
Alternative Gene Name: C17orf56, ENTHD2, FLJ31528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025377: 89%, ENSRNOG00000028161: 90%
Entrez Gene ID: 146705
Uniprot ID: Q96N21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEPSIN
Alternative Gene Name: C17orf56, ENTHD2, FLJ31528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025377: 89%, ENSRNOG00000028161: 90%
Entrez Gene ID: 146705
Uniprot ID: Q96N21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR |
Documents & Links for Anti TEPSIN pAb (ATL-HPA063410) | |
Datasheet | Anti TEPSIN pAb (ATL-HPA063410) Datasheet (External Link) |
Vendor Page | Anti TEPSIN pAb (ATL-HPA063410) at Atlas |
Documents & Links for Anti TEPSIN pAb (ATL-HPA063410) | |
Datasheet | Anti TEPSIN pAb (ATL-HPA063410) Datasheet (External Link) |
Vendor Page | Anti TEPSIN pAb (ATL-HPA063410) |