Protein Description: tektin 4
Gene Name: TEKT4
Alternative Gene Name: MGC27019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024175: 74%, ENSRNOG00000018792: 71%
Entrez Gene ID: 150483
Uniprot ID: Q8WW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEKT4
Alternative Gene Name: MGC27019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024175: 74%, ENSRNOG00000018792: 71%
Entrez Gene ID: 150483
Uniprot ID: Q8WW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER |
| Documents & Links for Anti TEKT4 pAb (ATL-HPA069872) | |
| Datasheet | Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link) |
| Vendor Page | Anti TEKT4 pAb (ATL-HPA069872) at Atlas |
| Documents & Links for Anti TEKT4 pAb (ATL-HPA069872) | |
| Datasheet | Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link) |
| Vendor Page | Anti TEKT4 pAb (ATL-HPA069872) |