Anti TEKT4 pAb (ATL-HPA069872)

Catalog No:
ATL-HPA069872-25
$447.00

Description

Product Description

Protein Description: tektin 4
Gene Name: TEKT4
Alternative Gene Name: MGC27019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024175: 74%, ENSRNOG00000018792: 71%
Entrez Gene ID: 150483
Uniprot ID: Q8WW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER
Gene Sequence QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER
Gene ID - Mouse ENSMUSG00000024175
Gene ID - Rat ENSRNOG00000018792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEKT4 pAb (ATL-HPA069872)
Datasheet Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link)
Vendor Page Anti TEKT4 pAb (ATL-HPA069872) at Atlas Antibodies

Documents & Links for Anti TEKT4 pAb (ATL-HPA069872)
Datasheet Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link)
Vendor Page Anti TEKT4 pAb (ATL-HPA069872)

Product Description

Protein Description: tektin 4
Gene Name: TEKT4
Alternative Gene Name: MGC27019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024175: 74%, ENSRNOG00000018792: 71%
Entrez Gene ID: 150483
Uniprot ID: Q8WW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER
Gene Sequence QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER
Gene ID - Mouse ENSMUSG00000024175
Gene ID - Rat ENSRNOG00000018792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEKT4 pAb (ATL-HPA069872)
Datasheet Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link)
Vendor Page Anti TEKT4 pAb (ATL-HPA069872) at Atlas Antibodies

Documents & Links for Anti TEKT4 pAb (ATL-HPA069872)
Datasheet Anti TEKT4 pAb (ATL-HPA069872) Datasheet (External Link)
Vendor Page Anti TEKT4 pAb (ATL-HPA069872)