Anti TEKT1 pAb (ATL-HPA062285)

Catalog No:
ATL-HPA062285-25
$447.00

Description

Product Description

Protein Description: tektin 1
Gene Name: TEKT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020799: 80%, ENSRNOG00000014973: 85%
Entrez Gene ID: 83659
Uniprot ID: Q969V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
Gene Sequence IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
Gene ID - Mouse ENSMUSG00000020799
Gene ID - Rat ENSRNOG00000014973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEKT1 pAb (ATL-HPA062285)
Datasheet Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link)
Vendor Page Anti TEKT1 pAb (ATL-HPA062285) at Atlas Antibodies

Documents & Links for Anti TEKT1 pAb (ATL-HPA062285)
Datasheet Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link)
Vendor Page Anti TEKT1 pAb (ATL-HPA062285)

Product Description

Protein Description: tektin 1
Gene Name: TEKT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020799: 80%, ENSRNOG00000014973: 85%
Entrez Gene ID: 83659
Uniprot ID: Q969V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
Gene Sequence IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
Gene ID - Mouse ENSMUSG00000020799
Gene ID - Rat ENSRNOG00000014973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TEKT1 pAb (ATL-HPA062285)
Datasheet Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link)
Vendor Page Anti TEKT1 pAb (ATL-HPA062285) at Atlas Antibodies

Documents & Links for Anti TEKT1 pAb (ATL-HPA062285)
Datasheet Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link)
Vendor Page Anti TEKT1 pAb (ATL-HPA062285)