Protein Description: tektin 1
Gene Name: TEKT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020799: 80%, ENSRNOG00000014973: 85%
Entrez Gene ID: 83659
Uniprot ID: Q969V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEKT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020799: 80%, ENSRNOG00000014973: 85%
Entrez Gene ID: 83659
Uniprot ID: Q969V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV |
Documents & Links for Anti TEKT1 pAb (ATL-HPA062285) | |
Datasheet | Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link) |
Vendor Page | Anti TEKT1 pAb (ATL-HPA062285) at Atlas |
Documents & Links for Anti TEKT1 pAb (ATL-HPA062285) | |
Datasheet | Anti TEKT1 pAb (ATL-HPA062285) Datasheet (External Link) |
Vendor Page | Anti TEKT1 pAb (ATL-HPA062285) |