Protein Description: TEA domain family member 2
Gene Name: TEAD2
Alternative Gene Name: ETF, TEF-4, TEF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030796: 94%, ENSRNOG00000020695: 96%
Entrez Gene ID: 8463
Uniprot ID: Q15562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEAD2
Alternative Gene Name: ETF, TEF-4, TEF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030796: 94%, ENSRNOG00000020695: 96%
Entrez Gene ID: 8463
Uniprot ID: Q15562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV |
Documents & Links for Anti TEAD2 pAb (ATL-HPA066292) | |
Datasheet | Anti TEAD2 pAb (ATL-HPA066292) Datasheet (External Link) |
Vendor Page | Anti TEAD2 pAb (ATL-HPA066292) at Atlas |
Documents & Links for Anti TEAD2 pAb (ATL-HPA066292) | |
Datasheet | Anti TEAD2 pAb (ATL-HPA066292) Datasheet (External Link) |
Vendor Page | Anti TEAD2 pAb (ATL-HPA066292) |