Protein Description: tudor domain containing 6
Gene Name: TDRD6
Alternative Gene Name: bA446F17.4, CT41.2, NY-CO-45, SPATA36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040140: 68%, ENSRNOG00000025693: 67%
Entrez Gene ID: 221400
Uniprot ID: O60522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TDRD6
Alternative Gene Name: bA446F17.4, CT41.2, NY-CO-45, SPATA36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040140: 68%, ENSRNOG00000025693: 67%
Entrez Gene ID: 221400
Uniprot ID: O60522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VSVVHTNKIGRLDLVNAILPGLCIHCSLQGFEVPDNKNSKKMMHYFSQRTSEAAIRCEFVKFQDRWEVILADEHGIIADDMISRY |
Documents & Links for Anti TDRD6 pAb (ATL-HPA077353) | |
Datasheet | Anti TDRD6 pAb (ATL-HPA077353) Datasheet (External Link) |
Vendor Page | Anti TDRD6 pAb (ATL-HPA077353) at Atlas |
Documents & Links for Anti TDRD6 pAb (ATL-HPA077353) | |
Datasheet | Anti TDRD6 pAb (ATL-HPA077353) Datasheet (External Link) |
Vendor Page | Anti TDRD6 pAb (ATL-HPA077353) |