Protein Description: tyrosyl-DNA phosphodiesterase 1
Gene Name: TDP1
Alternative Gene Name: FLJ11090, SCAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021177: 65%, ENSRNOG00000003831: 72%
Entrez Gene ID: 55775
Uniprot ID: Q9NUW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TDP1
Alternative Gene Name: FLJ11090, SCAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021177: 65%, ENSRNOG00000003831: 72%
Entrez Gene ID: 55775
Uniprot ID: Q9NUW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM |
| Documents & Links for Anti TDP1 pAb (ATL-HPA071317) | |
| Datasheet | Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link) |
| Vendor Page | Anti TDP1 pAb (ATL-HPA071317) at Atlas |
| Documents & Links for Anti TDP1 pAb (ATL-HPA071317) | |
| Datasheet | Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link) |
| Vendor Page | Anti TDP1 pAb (ATL-HPA071317) |