Anti TDP1 pAb (ATL-HPA071317)

Catalog No:
ATL-HPA071317-25
$447.00

Description

Product Description

Protein Description: tyrosyl-DNA phosphodiesterase 1
Gene Name: TDP1
Alternative Gene Name: FLJ11090, SCAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021177: 65%, ENSRNOG00000003831: 72%
Entrez Gene ID: 55775
Uniprot ID: Q9NUW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM
Gene Sequence STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM
Gene ID - Mouse ENSMUSG00000021177
Gene ID - Rat ENSRNOG00000003831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TDP1 pAb (ATL-HPA071317)
Datasheet Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link)
Vendor Page Anti TDP1 pAb (ATL-HPA071317) at Atlas Antibodies

Documents & Links for Anti TDP1 pAb (ATL-HPA071317)
Datasheet Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link)
Vendor Page Anti TDP1 pAb (ATL-HPA071317)

Product Description

Protein Description: tyrosyl-DNA phosphodiesterase 1
Gene Name: TDP1
Alternative Gene Name: FLJ11090, SCAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021177: 65%, ENSRNOG00000003831: 72%
Entrez Gene ID: 55775
Uniprot ID: Q9NUW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM
Gene Sequence STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM
Gene ID - Mouse ENSMUSG00000021177
Gene ID - Rat ENSRNOG00000003831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TDP1 pAb (ATL-HPA071317)
Datasheet Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link)
Vendor Page Anti TDP1 pAb (ATL-HPA071317) at Atlas Antibodies

Documents & Links for Anti TDP1 pAb (ATL-HPA071317)
Datasheet Anti TDP1 pAb (ATL-HPA071317) Datasheet (External Link)
Vendor Page Anti TDP1 pAb (ATL-HPA071317)