Protein Description: transcription factor like 5
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA |
| Documents & Links for Anti TCFL5 pAb (ATL-HPA076419) | |
| Datasheet | Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link) |
| Vendor Page | Anti TCFL5 pAb (ATL-HPA076419) at Atlas |
| Documents & Links for Anti TCFL5 pAb (ATL-HPA076419) | |
| Datasheet | Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link) |
| Vendor Page | Anti TCFL5 pAb (ATL-HPA076419) |