Description
Product Description
Protein Description: transcription factor like 5
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA |
Gene Sequence | ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA |
Gene ID - Mouse | ENSMUSG00000038932 |
Gene ID - Rat | ENSRNOG00000061199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TCFL5 pAb (ATL-HPA076419) | |
Datasheet | Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link) |
Vendor Page | Anti TCFL5 pAb (ATL-HPA076419) at Atlas Antibodies |
Documents & Links for Anti TCFL5 pAb (ATL-HPA076419) | |
Datasheet | Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link) |
Vendor Page | Anti TCFL5 pAb (ATL-HPA076419) |