Anti TCFL5 pAb (ATL-HPA076419)

Catalog No:
ATL-HPA076419-25
$447.00

Description

Product Description

Protein Description: transcription factor like 5
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA
Gene Sequence ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA
Gene ID - Mouse ENSMUSG00000038932
Gene ID - Rat ENSRNOG00000061199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TCFL5 pAb (ATL-HPA076419)
Datasheet Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link)
Vendor Page Anti TCFL5 pAb (ATL-HPA076419) at Atlas Antibodies

Documents & Links for Anti TCFL5 pAb (ATL-HPA076419)
Datasheet Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link)
Vendor Page Anti TCFL5 pAb (ATL-HPA076419)

Product Description

Protein Description: transcription factor like 5
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 99%, ENSRNOG00000061199: 99%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA
Gene Sequence ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA
Gene ID - Mouse ENSMUSG00000038932
Gene ID - Rat ENSRNOG00000061199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TCFL5 pAb (ATL-HPA076419)
Datasheet Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link)
Vendor Page Anti TCFL5 pAb (ATL-HPA076419) at Atlas Antibodies

Documents & Links for Anti TCFL5 pAb (ATL-HPA076419)
Datasheet Anti TCFL5 pAb (ATL-HPA076419) Datasheet (External Link)
Vendor Page Anti TCFL5 pAb (ATL-HPA076419)