Anti TCFL5 pAb (ATL-HPA055223 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA055223-25

• 
• 

Product Description

Protein Description: transcription factor-like 5 (basic helix-loop-helix)
Gene Name: TCFL5
Alternative Gene Name: bHLHe82, CHA, E2BP-1, Figlb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038932: 88%, ENSRNOG00000061199: 91%
Entrez Gene ID: 10732
Uniprot ID: Q9UL49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
• Gene Sequence: KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
• Gene ID - Mouse: ENSMUSG00000038932
• Gene ID - Rat: ENSRNOG00000061199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti TCFL5 pAb (ATL-HPA055223 w/enhanced validation) – 1 Found

Yu, Tianxiong; Biasini, Adriano; Cecchini, Katharine; Saflund, Martin; Mou, Haiwei; Arif, Amena; Eghbali, Atiyeh; de Rooij, Dirk; Weng, Zhiping; Zamore, Phillip D; Ozata, Deniz M. A-MYB/TCFL5 regulatory architecture ensures the production of pachytene piRNAs in placental mammals. Rna (New York, N.y.). 2022;29(1):30-43.