Protein Description: transcription factor 7-like 1 (T-cell specific, HMG-box)
Gene Name: TCF7L1
Alternative Gene Name: TCF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055799: 96%, ENSRNOG00000014753: 99%
Entrez Gene ID: 83439
Uniprot ID: Q9HCS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCF7L1
Alternative Gene Name: TCF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055799: 96%, ENSRNOG00000014753: 99%
Entrez Gene ID: 83439
Uniprot ID: Q9HCS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP |
Documents & Links for Anti TCF7L1 pAb (ATL-HPA071298) | |
Datasheet | Anti TCF7L1 pAb (ATL-HPA071298) Datasheet (External Link) |
Vendor Page | Anti TCF7L1 pAb (ATL-HPA071298) at Atlas |
Documents & Links for Anti TCF7L1 pAb (ATL-HPA071298) | |
Datasheet | Anti TCF7L1 pAb (ATL-HPA071298) Datasheet (External Link) |
Vendor Page | Anti TCF7L1 pAb (ATL-HPA071298) |