Anti TCF7L1 pAb (ATL-HPA071298)

Atlas Antibodies

Catalog No: ATL-HPA071298-25

• 

Product Description

Protein Description: transcription factor 7-like 1 (T-cell specific, HMG-box)
Gene Name: TCF7L1
Alternative Gene Name: TCF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055799: 96%, ENSRNOG00000014753: 99%
Entrez Gene ID: 83439
Uniprot ID: Q9HCS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
• Gene Sequence: ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
• Gene ID - Mouse: ENSMUSG00000055799
• Gene ID - Rat: ENSRNOG00000014753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.