Protein Description: transcription factor 19
Gene Name: TCF19
Alternative Gene Name: SC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050410: 52%, ENSRNOG00000058288: 52%
Entrez Gene ID: 6941
Uniprot ID: Q9Y242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCF19
Alternative Gene Name: SC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050410: 52%, ENSRNOG00000058288: 52%
Entrez Gene ID: 6941
Uniprot ID: Q9Y242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP |
Documents & Links for Anti TCF19 pAb (ATL-HPA065994) | |
Datasheet | Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link) |
Vendor Page | Anti TCF19 pAb (ATL-HPA065994) at Atlas |
Documents & Links for Anti TCF19 pAb (ATL-HPA065994) | |
Datasheet | Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link) |
Vendor Page | Anti TCF19 pAb (ATL-HPA065994) |