Anti TCF19 pAb (ATL-HPA065994)

Catalog No:
ATL-HPA065994-25
$447.00

Description

Product Description

Protein Description: transcription factor 19
Gene Name: TCF19
Alternative Gene Name: SC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050410: 52%, ENSRNOG00000058288: 52%
Entrez Gene ID: 6941
Uniprot ID: Q9Y242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP
Gene Sequence TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP
Gene ID - Mouse ENSMUSG00000050410
Gene ID - Rat ENSRNOG00000058288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TCF19 pAb (ATL-HPA065994)
Datasheet Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link)
Vendor Page Anti TCF19 pAb (ATL-HPA065994) at Atlas Antibodies

Documents & Links for Anti TCF19 pAb (ATL-HPA065994)
Datasheet Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link)
Vendor Page Anti TCF19 pAb (ATL-HPA065994)

Product Description

Protein Description: transcription factor 19
Gene Name: TCF19
Alternative Gene Name: SC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050410: 52%, ENSRNOG00000058288: 52%
Entrez Gene ID: 6941
Uniprot ID: Q9Y242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP
Gene Sequence TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP
Gene ID - Mouse ENSMUSG00000050410
Gene ID - Rat ENSRNOG00000058288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TCF19 pAb (ATL-HPA065994)
Datasheet Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link)
Vendor Page Anti TCF19 pAb (ATL-HPA065994) at Atlas Antibodies

Documents & Links for Anti TCF19 pAb (ATL-HPA065994)
Datasheet Anti TCF19 pAb (ATL-HPA065994) Datasheet (External Link)
Vendor Page Anti TCF19 pAb (ATL-HPA065994)