Protein Description: transcription factor 12
Gene Name: TCF12
Alternative Gene Name: bHLHb20, HEB, HsT17266, HTF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032228: 96%, ENSRNOG00000057754: 96%
Entrez Gene ID: 6938
Uniprot ID: Q99081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCF12
Alternative Gene Name: bHLHb20, HEB, HsT17266, HTF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032228: 96%, ENSRNOG00000057754: 96%
Entrez Gene ID: 6938
Uniprot ID: Q99081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRP |
Documents & Links for Anti TCF12 pAb (ATL-HPA065827) | |
Datasheet | Anti TCF12 pAb (ATL-HPA065827) Datasheet (External Link) |
Vendor Page | Anti TCF12 pAb (ATL-HPA065827) at Atlas |
Documents & Links for Anti TCF12 pAb (ATL-HPA065827) | |
Datasheet | Anti TCF12 pAb (ATL-HPA065827) Datasheet (External Link) |
Vendor Page | Anti TCF12 pAb (ATL-HPA065827) |