Anti TCERG1 pAb (ATL-HPA069808)

Atlas Antibodies

Catalog No: ATL-HPA069808-25

• 

Product Description

Protein Description: transcription elongation regulator 1
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 100%, ENSRNOG00000018849: 100%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADG
• Gene Sequence: PAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADG
• Gene ID - Mouse: ENSMUSG00000024498
• Gene ID - Rat: ENSRNOG00000018849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.