Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation)

Catalog No:
ATL-HPA064854-25
$303.00

Description

Product Description

Protein Description: transcription elongation regulator 1
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 100%, ENSRNOG00000018849: 100%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Gene Sequence KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Gene ID - Mouse ENSMUSG00000024498
Gene ID - Rat ENSRNOG00000018849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation)
Datasheet Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation)

Product Description

Protein Description: transcription elongation regulator 1
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 100%, ENSRNOG00000018849: 100%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Gene Sequence KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Gene ID - Mouse ENSMUSG00000024498
Gene ID - Rat ENSRNOG00000018849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation)
Datasheet Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation)