Protein Description: transcription elongation regulator 1
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 100%, ENSRNOG00000018849: 100%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 100%, ENSRNOG00000018849: 100%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV |
Documents & Links for Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) | |
Datasheet | Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) at Atlas |
Documents & Links for Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) | |
Datasheet | Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TCERG1 pAb (ATL-HPA064854 w/enhanced validation) |